Details

Species reactivity

Human

UniProt number

P01583

Estimated molecular weight

18 kDa

 

Group

recombinants

Origin

Escherichia coli

Shipping condition

Ambient/Room Temperature

 

Source

Recombinants or rec. proteins

Protein purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin level

Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.

 

Package form

Lyophilized from a 0.2 µm filtered solution of 20mM TrisHCl, 150mM NaCl, pH 7.5.

Description

Recombinant Human Interleukin-1 alpha is produced by our E.coli expression system and the target gene encoding Ser113-Ala271 is expressed.

Peptide sequence

SAPFSFLSNVKYNFMRIIKYEFILNDALNQSIIRANDQYLTAAALHNLDEAVKFDMGAYKSSKDDAKITVILRISKTQLYVTAQDEDQPVLLKEMPEIPKTITGSETNLLFFWETHGTKNYFTSVAHPNLFIATKQDYWVCLAGGPPSITDFQILENQA

 

Storage conditions

Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at below -20°C for 3 months.

Reconstitution conditions

Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 µg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

Properties

Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.