Details

Source

Yeast

Entrez Gene ID

403974

Alias'

IL-1F2

 

Shipping

Ambient

Storage

-20 °C

Product Type

Protein

 

MW

17.5 kDa

Target

IL-1 beta

Form

Lyophilized

 

Group

recombinants

Additional source

Recombinants or rec. proteins

Protein Sequence

AAMQSVDCKLQDISHKYLVLSNSYELRALHLNGENVNKQVVFHMSFVHGDESNNKIPVVLGIKQKNLYLSCVMKDGKPTLQLEKVDPKVYPKRKMEKRFVFNKIEIKNTVEFESSQYPNWYISTSQVEGMPVFLGNTRGGQDITDFTMEFSS

 

Gene

The Interleukin-1 family (IL-1 family) is a group of 11 cytokines, which plays a central role in the regulation of immune and inflammatory responses to infections or sterile insults. Rec. E. coli interleukin-1 for cell culture or antibody production.